Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEMA7A polyclonal antibody

  • Catalog # : PAB31251
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human SEMA7A.
  • Immunogen:
  • Recombinant protein corresponding to human SEMA7A.
  • Sequence:
  • QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with SEMA7A polyclonal antibody (Cat # PAB31251).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with SEMA7A polyclonal antibody (Cat # PAB31251) shows distinct cytoplasmic and membranous positivity in glandular cells.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8482
  • Gene Name:
  • SEMA7A
  • Gene Alias:
  • CD108,CDw108,H-SEMA-K1,H-Sema-L,JMH,MGC126692,MGC126696,SEMAK1,SEMAL
  • Gene Description:
  • semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
  • Gene Summary:
  • The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • John Milton Hagen blood group H-Sema K1,sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin) 7A (JMH blood group),sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, 7A,semaphorin 7A,semaphorin K1,semaphorin L
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook