UBE2D2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast shows cytoplasmic and nuclear positivity in glandular cells.
Immunofluorescence
Immunofluorescence staining of U-251MG cell line with antibody shows positivity in plasma membrane and cytosol(green).
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human UBE2D2.
Immunogen
Recombinant protein corresponding to human UBE2D2.
Sequence
LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Immunofluorescence (0.25-2 ug/mL)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast shows cytoplasmic and nuclear positivity in glandular cells.Immunofluorescence
Immunofluorescence staining of U-251MG cell line with antibody shows positivity in plasma membrane and cytosol(green). -
Gene Info — UBE2D2
Entrez GeneID
7322Protein Accession#
P62837Gene Name
UBE2D2
Gene Alias
E2(17)KB2, PUBC1, UBC4, UBC4/5, UBCH5B
Gene Description
ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
Omim ID
602962Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq
Other Designations
ubiquitin carrier protein|ubiquitin-conjugating enzyme E2 D2|ubiquitin-conjugating enzyme E2-17 kDa 2|ubiquitin-conjugating enzyme E2D 2|ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com