LPAR2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with LPAR2 polyclonal antibody (Cat # PAB30912) shows strong cytoplasmic and membranous positivity in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human LPAR2.
Immunogen
Recombinant protein corresponding to human LPAR2.
Sequence
LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with LPAR2 polyclonal antibody (Cat # PAB30912) shows strong cytoplasmic and membranous positivity in glandular cells. -
Gene Info — LPAR2
Entrez GeneID
9170Protein Accession#
Q9HBW0Gene Name
LPAR2
Gene Alias
EDG-4, EDG4, FLJ93869, LPA2
Gene Description
lysophosphatidic acid receptor 2
Omim ID
605110Gene Ontology
HyperlinkGene Summary
This gene encodes a member of family I of the G protein-coupled receptors, as well as the EDG family of proteins. This protein functions as a lysophosphatidic acid (LPA) receptor and contributes to Ca2+ mobilization, a critical cellular response to LPA in cells, through association with Gi and Gq proteins. An alternative splice variant has been described but its full length sequence has not been determined. [provided by RefSeq
Other Designations
G protein-coupled receptor|LPA receptor EDG4|endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 4|lysophosphatidic acid receptor EDG4
-
Interactome
-
Pathway
-
Publication Reference
-
Lysophosphatidic acid activates Arf6 to promote the mesenchymal malignancy of renal cancer.
Hashimoto S, Mikami S, Sugino H, Yoshikawa A, Hashimoto A, Onodera Y, Furukawa S, Handa H, Oikawa T, Okada Y, Oya M, Sabe H.
Nature Communications 2016 Feb; 7:10656.
Application：IHC-P, Human, Human renal cancer.
-
LPA Induces Colon Cancer Cell Proliferation through a Cooperation between the ROCK and STAT-3 Pathways.
Leve F, Peres-Moreira RJ, Binato R, Abdelhay E, Morgado-Díaz JA.
PLoS One 2015 Sep; 10(9):e0139094.
Application：WB-Ce, Human, Caco-2 cells, HCT-116 cells, HT-29 cells.
-
In vivo collective cell migration requires an LPAR2-dependent increase in tissue fluidity.
Kuriyama S, Theveneau E, Benedetto A, Parsons M, Tanaka M, Charras G, Kabla A, Mayor R.
The Journal of Cell Biology 2014 Jul; 206(1):113.
Application：WB-Ce, Frog, Neural crest cells.
-
Lysophosphatidic acid activates Arf6 to promote the mesenchymal malignancy of renal cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com