AKT3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human AKT3.
Immunogen
Recombinant protein corresponding to human AKT3.
Sequence
EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of SH-SY5Y with AKT3 polyclonal antibody (Cat # PAB30870).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with AKT3 polyclonal antibody (Cat # PAB30870) shows strong nuclear and cytoplasmic positivity in neuronal cells.Immunofluorescence
Immunofluorescent staining of U-2 OS with AKT3 polyclonal antibody (Cat # PAB30870) (Green) shows positivity in plasma membrane and cytoplasm. -
Gene Info — AKT3
Entrez GeneID
10000Protein Accession#
Q9Y243Gene Name
AKT3
Gene Alias
DKFZp434N0250, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2
Gene Description
v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Omim ID
611223Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000037911|OTTHUMP00000037912|RAC-gamma serine/threonine protein kinase|protein kinase B gamma|serine threonine protein kinase, Akt-3|v-akt murine thymoma viral oncogene homolog 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Investigation of molecular alterations of AKT-3 in triple-negative breast cancer.
O'Hurley G, Daly E, O'Grady A, Cummins R, Quinn C, Flanagan L, Pierce A, Fan Y, Lynn MA, Rafferty M, Fitzgerald D, Pontén F, Duffy MJ, Jirström K, Kay EW, Gallagher WM.
Histopathology 2014 Apr; 64(5):660.
-
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.
Charlotte Stadler, Elton Rexhepaj, Vasanth R Singan, Robert F Murphy, Rainer Pepperkok, Mathias Uhlén, Jeremy C Simpson, Emma Lundberg.
Nature Methods 2013 Apr; 10(4):315.
-
Abrogation of BRAFV600E-induced senescence by PI3K pathway activation contributes to melanomagenesis.
Vredeveld LC, Possik PA, Smit MA, Meissl K, Michaloglou C, Horlings HM, Ajouaou A, Kortman PC, Dankort D, McMahon M, Mooi WJ, Peeper DS.
Genes & Development 2012 May; 26(10):1055.
Application:IHC-P, WB-Tr, Human, Melanocytes, Melanoma.
-
Investigation of molecular alterations of AKT-3 in triple-negative breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com