RAPGEF1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with RAPGEF1 polyclonal antibody (Cat # PAB30758).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with RAPGEF1 polyclonal antibody (Cat # PAB30758) shows strong cytoplasmic positivity in myocytes.
Immunofluorescence
Immunofluorescent staining of U-251 MG with RAPGEF1 polyclonal antibody (Cat # PAB30758) (Green) shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human RAPGEF1.
Immunogen
Recombinant protein corresponding to human RAPGEF1.
Sequence
SWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with RAPGEF1 polyclonal antibody (Cat # PAB30758).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with RAPGEF1 polyclonal antibody (Cat # PAB30758) shows strong cytoplasmic positivity in myocytes.Immunofluorescence
Immunofluorescent staining of U-251 MG with RAPGEF1 polyclonal antibody (Cat # PAB30758) (Green) shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — RAPGEF1
Entrez GeneID
2889Protein Accession#
Q13905Gene Name
RAPGEF1
Gene Alias
C3G, DKFZp781P1719, GRF2
Gene Description
Rap guanine nucleotide exchange factor (GEF) 1
Omim ID
600303Gene Ontology
HyperlinkGene Summary
This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000064558|guanine nucleotide-releasing factor 2|guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com