PRMT5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with PRMT5 polyclonal antibody (Cat # PAB30739).
Western Blot
Western Blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: human plasma (IgG/HSA depleted), Lane 4: human liver and Lane 5: human tonsil lysates with PRMT5 polyclonal antibody (Cat # PAB30739).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with PRMT5 polyclonal antibody (Cat # PAB30739) shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunofluorescence
Immunofluorescent staining of U-251 MG with PRMT5 polyclonal antibody (Cat # PAB30739) (Green) shows positivity in nucleus and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human PRMT5.
Immunogen
Recombinant protein corresponding to human PRMT5.
Sequence
LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with PRMT5 polyclonal antibody (Cat # PAB30739).Western Blot
Western Blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: human plasma (IgG/HSA depleted), Lane 4: human liver and Lane 5: human tonsil lysates with PRMT5 polyclonal antibody (Cat # PAB30739).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with PRMT5 polyclonal antibody (Cat # PAB30739) shows moderate cytoplasmic positivity in cells in seminiferous ducts.Immunofluorescence
Immunofluorescent staining of U-251 MG with PRMT5 polyclonal antibody (Cat # PAB30739) (Green) shows positivity in nucleus and cytoplasm. -
Gene Info — PRMT5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com