RAD17 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with RAD17 polyclonal antibody (Cat # PAB30729).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with RAD17 polyclonal antibody (Cat # PAB30729) shows strong nuclear positivity in cells in seminiferous ducts.
Immunofluorescence
Immunofluorescent staining of U-2 OS with RAD17 polyclonal antibody (Cat # PAB30729) (Green) shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human RAD17.
Immunogen
Recombinant protein corresponding to human RAD17.
Sequence
SKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with RAD17 polyclonal antibody (Cat # PAB30729).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with RAD17 polyclonal antibody (Cat # PAB30729) shows strong nuclear positivity in cells in seminiferous ducts.Immunofluorescence
Immunofluorescent staining of U-2 OS with RAD17 polyclonal antibody (Cat # PAB30729) (Green) shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — RAD17
Entrez GeneID
5884Protein Accession#
O75943Gene Name
RAD17
Gene Alias
CCYC, FLJ41520, HRAD17, R24L, RAD17SP, RAD24
Gene Description
RAD17 homolog (S. pombe)
Omim ID
603139Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by the checkpoint kinase ATR following damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Eight alternatively spliced transcript variants of this gene, which encode four distinct proteins, have been reported. Two pseudogenes, located on chromosomes 7 and 13, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000125189|OTTHUMP00000125190|OTTHUMP00000125192|OTTHUMP00000125193|OTTHUMP00000125194|RAD1 homolog|RAD17 homolog|RF-C activator 1 homolog|Rad17-like protein|cell cycle checkpoint protein (RAD17)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com