Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNF3 polyclonal antibody

  • Catalog # : PAB30639
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human ZNF3.
  • Immunogen:
  • Recombinant protein corresponding to human ZNF3.
  • Sequence:
  • SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRK
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex (A, B), human cerebellum (C) and human duodenum (D) with ZNF3 polyclonal antibody (Cat # PAB30639). A: Human cerebral cortex shows nuclear positivity in neuronal cells. B: Human cerebral cortex shows strong nuclear immunoreactivity in neurons. C: Human cerebellum shows nuclear positivity in Purkinje cells, as well as in the molecular and granular cell layers. D: Human duodenum shows strong nuclear positivity in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251 MG (A), mouse midbrain (B), mouse piriform cortex (C), mouse hypothalamus (D, E) and mouse visual cortex (F) with ZNF3 polyclonal antibody (Cat # PAB30639) (Green). A: U-251 MG shows positivity in nucleus but excluded from the nucleoli. B: Mouse midbrain shows nuclear staining in neurons of the oculomotor and red nuclei. C: Mouse piriform cortex shows nuclear staining in the neurons of layer 2. D: Mouse hypothalamus shows nuclear positivity in the neurons of medial preoptic area. E: Mouse hypothalamus shows nuclear immunoreactivity in the neurons in the arcuate nucleus. F: Mouse visual cortex shows nuclear positivity in neurons.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7551
  • Gene Name:
  • ZNF3
  • Gene Alias:
  • A8-51,FLJ20216,HF.12,KOX25,PP838,Zfp113
  • Gene Description:
  • zinc finger protein 3
  • Other Designations:
  • C2-H2 type zinc finger protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook