LCK polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: human plasma (IgG/HSA depleted), Lane 4: human liver and Lane 5: human tonsil lysates with LCK polyclonal antibody (Cat # PAB30622).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with LCK polyclonal antibody (Cat # PAB30622) shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Immunofluorescence
Immunofluorescent staining of A-431 cells with LCK polyclonal antibody (Cat # PAB30622) (Green) shows positivity in the Golgi apparatus.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human LCK.
Immunogen
Recombinant protein corresponding to human LCK.
Sequence
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: human plasma (IgG/HSA depleted), Lane 4: human liver and Lane 5: human tonsil lysates with LCK polyclonal antibody (Cat # PAB30622).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with LCK polyclonal antibody (Cat # PAB30622) shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.Immunofluorescence
Immunofluorescent staining of A-431 cells with LCK polyclonal antibody (Cat # PAB30622) (Green) shows positivity in the Golgi apparatus. -
Gene Info — LCK
Entrez GeneID
3932Protein Accession#
P06239Gene Name
LCK
Gene Alias
YT16, p56lck, pp58lck
Gene Description
lymphocyte-specific protein tyrosine kinase
Omim ID
153390Gene Ontology
HyperlinkGene Summary
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described. [provided by RefSeq
Other Designations
T-lymphocyte specific protein tyrosine kinase p56lck|p56(LSTRA) protein-tyrosine kinase|protein tyrosine kinase|proto-oncogene tyrosine-protein kinase LCK
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com