ATP6AP2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ATP6AP2.
Immunogen
Recombinant protein corresponding to human ATP6AP2.
Sequence
NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ATP6AP2 polyclonal antibody (Cat # PAB30616).Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with ATP6AP2 polyclonal antibody (Cat # PAB30616).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with ATP6AP2 polyclonal antibody (Cat # PAB30616) shows strong cytoplasmic positivity in Purkinje cells and in cells of granular layer.Immunofluorescence
Immunofluorescent staining of U-2 OS with ATP6AP2 polyclonal antibody (Cat # PAB30616) (Green) shows positivity in nucleus and nucleoli. -
Gene Info — ATP6AP2
Entrez GeneID
10159Protein Accession#
O75787Gene Name
ATP6AP2
Gene Alias
APT6M8-9, ATP6IP2, ATP6M8-9, ELDF10, HT028, M8-9, MGC99577, MRXE, MSTP009, XMRE
Gene Description
ATPase, H+ transporting, lysosomal accessory protein 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9|ATPase, H+ transporting, lysosomal interacting protein 2|OTTHUMP00000025771|V-ATPase M8.9 subunit|embryonic liver differentiation factor 10|renin receptor|va
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com