GEM polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human stomach tumor tissue lysate with GEM polyclonal antibody (Cat # PAB30100) at 1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with GEM polyclonal antibody (Cat # PAB30100) at 2.5 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human skin (B) with GEM polyclonal antibody (Cat # PAB30100) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human GEM.
Immunogen
A synthetic peptide corresponding to C-terminus of human GEM.
Sequence
ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW
Host
Rabbit
Theoretical MW (kDa)
33
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human stomach tumor tissue lysate with GEM polyclonal antibody (Cat # PAB30100) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with GEM polyclonal antibody (Cat # PAB30100) at 2.5 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human skin (B) with GEM polyclonal antibody (Cat # PAB30100) at 4-8 ug/mL working concentration. -
Gene Info — GEM
Entrez GeneID
2669GeneBank Accession#
NM_005261Protein Accession#
NP_005252;P55040Gene Name
GEM
Gene Alias
KIR, MGC26294
Gene Description
GTP binding protein overexpressed in skeletal muscle
Omim ID
600164Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
GTP-binding mitogen-induced T-cell protein|GTP-binding protein overexpressed in skeletal muscle|kinase-inducible Ras-like protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com