C4BPB polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal liver tissue lysate with C4BPB polyclonal antibody (Cat # PAB29985) at 0.2-1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of 721 B lymphoblast cell lysate with C4BPB polyclonal antibody (Cat # PAB29985) at 1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with C4BPB polyclonal antibody (Cat # PAB29985) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human C4BPB.
Immunogen
A synthetic peptide corresponding to N-terminus of human C4BPB.
Sequence
CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
Host
Rabbit
Theoretical MW (kDa)
28
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal liver tissue lysate with C4BPB polyclonal antibody (Cat # PAB29985) at 0.2-1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of 721 B lymphoblast cell lysate with C4BPB polyclonal antibody (Cat # PAB29985) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with C4BPB polyclonal antibody (Cat # PAB29985) at 4-8 ug/mL working concentration. -
Gene Info — C4BPB
Entrez GeneID
725GeneBank Accession#
NM_000716Protein Accession#
NP_000707;P20851Gene Name
C4BPB
Gene Alias
C4BP
Gene Description
complement component 4 binding protein, beta
Omim ID
120831Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq
Other Designations
C4b binding protein, beta chain|OTTHUMP00000034288|OTTHUMP00000034289|OTTHUMP00000034375|complement component 4 binding protein, beta chain|complement component 4-binding protein, beta
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com