ANXA4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human placenta tissue lysate with ANXA4 polyclonal antibody (Cat # PAB29960) at 1.25 ug/mL working concentration.
Western Blot (Tissue lysate)
Western Blot analysis of human fetal liver tissue lysate with ANXA4 polyclonal antibody (Cat # PAB29960) at 1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with ANXA4 polyclonal antibody (Cat # PAB29960) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human ANXA4.
Immunogen
A synthetic peptide corresponding to N-terminus of human ANXA4.
Sequence
GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Host
Rabbit
Theoretical MW (kDa)
35
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human placenta tissue lysate with ANXA4 polyclonal antibody (Cat # PAB29960) at 1.25 ug/mL working concentration.Western Blot (Tissue lysate)
Western Blot analysis of human fetal liver tissue lysate with ANXA4 polyclonal antibody (Cat # PAB29960) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with ANXA4 polyclonal antibody (Cat # PAB29960) at 4-8 ug/mL working concentration. -
Gene Info — ANXA4
Entrez GeneID
307GeneBank Accession#
NM_001153Protein Accession#
NP_001144;Q6LES2Gene Name
ANXA4
Gene Alias
ANX4, DKFZp686H02120, MGC75105, PIG28, ZAP36
Gene Description
annexin A4
Omim ID
106491Gene Ontology
HyperlinkGene Summary
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq
Other Designations
annexin IV|annexin IV (placental anticoagulant protein II)|placental anticoagulant protein II|proliferation-inducing gene 28|proliferation-inducing protein 28
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com