Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ANXA4 polyclonal antibody

  • Catalog # : PAB29960
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human ANXA4.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human ANXA4.
  • Sequence:
  • GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 35
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal liver tissue lysate with ANXA4 polyclonal antibody (Cat # PAB29960) at 1 ug/mL working concentration.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human placenta tissue lysate with ANXA4 polyclonal antibody (Cat # PAB29960) at 1.25 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with ANXA4 polyclonal antibody (Cat # PAB29960) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 307
  • Protein Accession#:
  • NP_001144;Q6LES2
  • Gene Name:
  • ANXA4
  • Gene Alias:
  • ANX4,DKFZp686H02120,MGC75105,PIG28,ZAP36
  • Gene Description:
  • annexin A4
  • Gene Summary:
  • Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq
  • Other Designations:
  • annexin IV,annexin IV (placental anticoagulant protein II),placental anticoagulant protein II,proliferation-inducing gene 28,proliferation-inducing protein 28
  • RSS
  • YouTube
  • Linkedin
  • Facebook