Product Browser

Last updated: 2016/9/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Pax7 polyclonal antibody

  • Catalog # : PAB29864
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of rat Pax7.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 201-250 of rat Pax7.
  • Sequence:
  • SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 55
  • Reactivity:
  • Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1:200)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to 1 week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western blot analysis of rat muscle tissue lysate with Pax7 polyclonal antibody (Cat # PAB29864).
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of mouse C2C12 cells overexpressing Pax7 with Pax7 polyclonal antibody (Cat # PAB29864).
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • Pax7
  • Gene Alias:
  • RGD1564360
  • Gene Description:
  • paired box 7
  • Other Designations:
  • paired box gene 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook