ABCB1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung cancer tissue with ABCB1 polyclonal antibody (Cat # PAB29562) under 0.5-1 ug/mL working concentration.
Immunohistochemistry (Frozen sections)
Immunohistochemical staining (Frozen sections) of mouse intestine tissue (A) and rat kidney tissue (B) with ABCB1 polyclonal antibody (Cat # PAB29562) under 0.5-1 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial synthetic protein of human ABCB1.
Immunogen
A synthetic peptide corresponding to amino acids 621-650 at internal region of human ABCB1.
Sequence
IYFKLVTMQTAGNEVELENAADESKSEIDA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Lyophilized
Purification
Immunogen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Frozen sections) (0.5-1 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from 0.9 mg NaCl, 0.2 mg Na2HPO4 (5 mg BSA, 0.05 mg sodium azide)
Storage Instruction
Store at -20°C.
After reconstitution with 0.2 mL of deionized water, store at 4°C for 1 month. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung cancer tissue with ABCB1 polyclonal antibody (Cat # PAB29562) under 0.5-1 ug/mL working concentration.Immunohistochemistry (Frozen sections)
Immunohistochemical staining (Frozen sections) of mouse intestine tissue (A) and rat kidney tissue (B) with ABCB1 polyclonal antibody (Cat # PAB29562) under 0.5-1 ug/mL working concentration. -
Gene Info — ABCB1
Entrez GeneID
5243Gene Name
ABCB1
Gene Alias
ABC20, CD243, CLCS, GP170, MDR1, MGC163296, P-GP, PGY1
Gene Description
ATP-binding cassette, sub-family B (MDR/TAP), member 1
Omim ID
171050Gene Ontology
HyperlinkGene Summary
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. [provided by RefSeq
Other Designations
ATP-binding cassette, subfamily B, member 1|P glycoprotein 1|P-glycoprotein 1|colchicin sensitivity|doxorubicin resistance|multidrug resistance 1|multidrug resistance protein 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com