CD207 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with CD207 polyclonal antibody (Cat# PAB29488) at 1:100 - 1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with CD207 polyclonal antibody (Cat# PAB29488) shows distinct cytoplasmic positivity in a subset of cells that resembled Langerhans cells at 1:20 - 1:50 dilution.
Immunofluorescence
Immunofluorescent staining of U-2 OS cells with CD207 polyclonal antibody (Cat# PAB29488) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green.
-
Specification
Product Description
CD207 polyclonal antibody raised against recombinant human CD207.
Immunogen
Recombinant protein corresponding to amino acids of human CD207.
Sequence
VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with CD207 polyclonal antibody (Cat# PAB29488) at 1:100 - 1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with CD207 polyclonal antibody (Cat# PAB29488) shows distinct cytoplasmic positivity in a subset of cells that resembled Langerhans cells at 1:20 - 1:50 dilution.Immunofluorescence
Immunofluorescent staining of U-2 OS cells with CD207 polyclonal antibody (Cat# PAB29488) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green. -
Gene Info — CD207
Entrez GeneID
50489Protein Accession#
Q9UJ71Gene Name
CD207
Gene Alias
CLEC4K
Gene Description
CD207 molecule, langerin
Omim ID
604862Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. [provided by RefSeq
Other Designations
C-type lectin domain family 4, member K|CD207 antigen, langerin|Langerhans cell specific c-type lectin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com