Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD207 polyclonal antibody

  • Catalog # : PAB29488
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • CD207 polyclonal antibody raised against recombinant human CD207.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human CD207.
  • Sequence:
  • VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:20-1:50)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with CD207 polyclonal antibody (Cat# PAB29488) at 1:100 - 1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with CD207 polyclonal antibody (Cat# PAB29488) shows distinct cytoplasmic positivity in a subset of cells that resembled Langerhans cells at 1:20 - 1:50 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS cells with CD207 polyclonal antibody (Cat# PAB29488) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • CD207
  • Gene Alias:
  • CLEC4K
  • Gene Description:
  • CD207 molecule, langerin
  • Gene Summary:
  • The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. [provided by RefSeq
  • Other Designations:
  • C-type lectin domain family 4, member K,CD207 antigen, langerin,Langerhans cell specific c-type lectin
  • RSS
  • YouTube
  • Linkedin
  • Facebook