RBL1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human RBL1.
Immunogen
Recombinant protein corresponding to human RBL1.
Sequence
DAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFEKKRSFAPSTPLTGRRYLRE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human plasma (IgG/HSA depleted) Lane 4: Human liver tissue Lane 5: Human tonsil tissue with RBL1 polyclonal antibody (Cat # PAB29467) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with RBL1 polyclonal antibody (Cat # PAB29467) shows moderate nuclear positivity in glandular cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with RBL1 polyclonal antibody (Cat # PAB29467) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — RBL1
Entrez GeneID
5933Gene Name
RBL1
Gene Alias
CP107, MGC40006, PRB1, p107
Gene Description
retinoblastoma-like 1 (p107)
Omim ID
116957Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
107 kDa retinoblastoma-associated protein|OTTHUMP00000030892|OTTHUMP00000030893|cellular protein 107|retinoblastoma-like protein 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com