RBL1 monoclonal antibody (M01), clone 1A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RBL1 expression in transfected 293T cell line by RBL1 monoclonal antibody (M01), clone 1A5.
Lane 1: RBL1 transfected lysate (Predicted MW: 111.54 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MYBL2 and RBL1. Mahlavu cells were stained with anti-MYBL2 rabbit purified polyclonal 1:1200 and anti-RBL1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RBL1.
Immunogen
RBL1 (AAH32247, 905 a.a. ~ 1014 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKVR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RBL1 expression in transfected 293T cell line by RBL1 monoclonal antibody (M01), clone 1A5.
Lane 1: RBL1 transfected lysate (Predicted MW: 111.54 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MYBL2 and RBL1. Mahlavu cells were stained with anti-MYBL2 rabbit purified polyclonal 1:1200 and anti-RBL1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — RBL1
Entrez GeneID
5933GeneBank Accession#
BC032247Protein Accession#
AAH32247Gene Name
RBL1
Gene Alias
CP107, MGC40006, PRB1, p107
Gene Description
retinoblastoma-like 1 (p107)
Omim ID
116957Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
107 kDa retinoblastoma-associated protein|OTTHUMP00000030892|OTTHUMP00000030893|cellular protein 107|retinoblastoma-like protein 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Mutation of SPINOPHILIN (PPP1R9B) found in human tumors promotes the tumorigenic and stemness properties of cells.
Eva M Verdugo-Sivianes, Ana M Rojas, Sandra Muñoz-Galván, Daniel Otero-Albiol, Amancio Carnero.
Theranostics 2021 Jan; 11(7):3452.
Application：WB-Ce, WB-Tr, Human, MDA-MB-468, T-47D cells.
-
Mutation of SPINOPHILIN (PPP1R9B) found in human tumors promotes the tumorigenic and stemness properties of cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com