Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC20 polyclonal antibody

  • Catalog # : PAB29462
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human CDC20.
  • Immunogen:
  • Recombinant protein corresponding to human CDC20.
  • Sequence:
  • TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human appendix with CDC20 polyclonal antibody (Cat # PAB29462) shows strong cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS with CDC20 polyclonal antibody (Cat # PAB29462) at 1-4 ug/mL concentration shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 991
  • Gene Name:
  • CDC20
  • Gene Alias:
  • CDC20A,MGC102824,bA276H19.3,p55CDC
  • Gene Description:
  • cell division cycle 20 homolog (S. cerevisiae)
  • Gene Summary:
  • CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by RefSeq
  • Other Designations:
  • CDC20 cell division cycle 20 homolog,OTTHUMP00000008571,OTTHUMP00000008572,cell division cycle 20
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook