BAT3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG with BAT3 polyclonal antibody (Cat # PAB29451) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with BAT3 polyclonal antibody (Cat # PAB29451) shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with BAT3 polyclonal antibody (Cat # PAB29451) at 1-4 ug/mL concentration shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
-
Specifications
Product Description
Rabbit polyclonal antibody raised against recombinant human BAT3.
Immunogen
Recombinant protein corresponding to human BAT3.
Sequence
SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG with BAT3 polyclonal antibody (Cat # PAB29451) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with BAT3 polyclonal antibody (Cat # PAB29451) shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with BAT3 polyclonal antibody (Cat # PAB29451) at 1-4 ug/mL concentration shows positivity in cytoplasm and nucleus but excluded from the nucleoli. -
Gene Info — BAT3
Entrez GeneID
7917Gene Name
BAT3
Gene Alias
BAG-6, BAG6, D6S52E, G3
Gene Description
HLA-B associated transcript 3
Omim ID
142590Gene Ontology
HyperlinkGene Summary
This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
HLA-B associated transcript-3|OTTHUMP00000029239|large proline-rich protein BAT3|scythe
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com