Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LIMA1 polyclonal antibody

  • Catalog # : PAB29449
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human LIMA1.
  • Immunogen:
  • Recombinant protein corresponding to human LIMA1.
  • Sequence:
  • RPHKDLWASKNENEEILERPAQLANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:500-1:1000)
    Immunofluorescence (1-4 ug/mL)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Human cell line RT-4 with LIMA1 polyclonal antibody (Cat # PAB29449) at 1:250-1:500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human kidney with LIMA1 polyclonal antibody (Cat # PAB29449) shows strong membranous positivity in cells in tubules at 1:500-1:1000 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS with LIMA1 polyclonal antibody (Cat # PAB29449) at 1-4 ug/mL concentration shows positivity in plasma membrane, actin filaments and focal adhesion sites.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • LIMA1
  • Gene Alias:
  • EPLIN,FLJ38853,MGC131726,SREBP3
  • Gene Description:
  • LIM domain and actin binding 1
  • Gene Summary:
  • EPLIN is a cytoskeleton-associated protein that inhibits actin filament depolymerization and cross-links filaments in bundles (Maul et al., 2003 [PubMed 12566430]).[supplied by OMIM
  • Other Designations:
  • 1110021C24Rik,epithelial protein lost in neoplasm beta,sterol regulatory element binding protein 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook