RPL28 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp with RPL28 polyclonal antibody (Cat # PAB29428) at 1:500-1:1000 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with RPL28 polyclonal antibody (Cat # PAB29428) shows strong cytoplasmic positivity in exocrine glandular cells at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line MCF7 with RPL28 polyclonal antibody (Cat # PAB29428) at 1-4 ug/mL concentration shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human RPL28.
Immunogen
Recombinant protein corresponding to human RPL28.
Sequence
QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp with RPL28 polyclonal antibody (Cat # PAB29428) at 1:500-1:1000 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with RPL28 polyclonal antibody (Cat # PAB29428) shows strong cytoplasmic positivity in exocrine glandular cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line MCF7 with RPL28 polyclonal antibody (Cat # PAB29428) at 1-4 ug/mL concentration shows positivity in cytoplasm. -
Gene Info — RPL28
Entrez GeneID
6158Gene Name
RPL28
Gene Alias
FLJ43307
Gene Description
ribosomal protein L28
Omim ID
603638Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L28E family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternative splicing results in multiple transcript variants encoding distinct isoforms
Other Designations
60S ribosomal protein L28
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com