Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLXNB2 polyclonal antibody

  • Catalog # : PAB28733
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant PLXNB2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human PLXNB2.
  • Sequence:
  • DSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human skeletal muscle with PLXNB2 polyclonal antibody (Cat # PAB28733) shows distinct cytoplasmic positivity in myocytes at 1:20-1:50 dilution.
  • Application Image
  • Gene Information
  • Gene Name:
  • PLXNB2
  • Gene Alias:
  • KIAA0315,MM1,Nbla00445,PLEXB2,dJ402G11.3
  • Gene Description:
  • plexin B2
  • Gene Summary:
  • Members of the B class of plexins, such as PLXNB2 are transmembrane receptors that participate in axon guidance and cell migration in response to semaphorins (Perrot et al. (2002) [PubMed 12183458]).[supplied by OMIM
  • Other Designations:
  • -
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook