Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZFYVE1 polyclonal antibody

  • Catalog # : PAB28731
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant ZFYVE1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human ZFYVE1.
  • Sequence:
  • IAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKHH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebellum with ZFYVE1 polyclonal antibody (Cat # PAB28731) shows moderate cytoplasmic positivity in purkinje cells at 1:50- 1:200 dilution.
  • Application Image
  • Gene Information
  • Gene Name:
  • ZFYVE1
  • Gene Alias:
  • DFCP1,KIAA1589,TAFF1,ZNFN2A1
  • Gene Description:
  • zinc finger, FYVE domain containing 1
  • Gene Summary:
  • The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains two zinc-binding FYVE domains in tandem. This protein displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes. [provided by RefSeq
  • Other Designations:
  • double FYVE-containing protein 1,phosphoinositide-binding protein SR3,tandem FYVE fingers-1 protein,zinc finger protein, subfamily 2A (FYVE domain containing), 1,zinc finger protein, subfamily 2A, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook