Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PSMD5 polyclonal antibody

  • Catalog # : PAB28719
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant PSMD5.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human PSMD5.
  • Sequence:
  • AAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLS
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    Immunofluorescence (1-4 ug/ml)
    Western Blot (1:100-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
    Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
    with PSMD5 polyclonal antibody (Cat # PAB28719) at 1:100-1:500 dilution.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human prostate with PSMD5 polyclonal antibody (Cat # PAB28719) shows strong strong nuclear positivity in glandular cells at 1:50-1:200 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with PSMD5 polyclonal antibody (Cat # PAB28719) at 1-4 ug/mL dilution shows positivity in nucleus and cytoplasm.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5711
  • Gene Name:
  • PSMD5
  • Gene Alias:
  • KIAA0072,MGC23145,S5B
  • Gene Description:
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
  • Gene Summary:
  • The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator base. [provided by RefSeq
  • Other Designations:
  • 26S protease subunit S5 basic,26S proteasome non-ATPase regulatory subunit 5,26S proteasome subunit S5B,OTTHUMP00000021990,proteasome 26S non-ATPase subunit 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook