Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DLG3 polyclonal antibody

  • Catalog # : PAB28478
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant DLG3
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human DLG3
  • Sequence:
  • HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry(1:50-1:200)
    Western Blot(1:100-1:250)
    Immunofluorescence(1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with DLG3 polyclonal antibody at 1:100-1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human cerebral cortex with DLG3 polyclonal antibody (Cat # PAB28478) shows distinct nuclear and cytoplasmic positivity in neuronal cells at 1:50-1:200 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS with DLG3 polyclonal antibody (Cat # PAB28478) at 1-4 ug/ml shows positivity in nucleus & nucleoli.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1741
  • Gene Name:
  • DLG3
  • Gene Alias:
  • KIAA1232,MRX,MRX90,NE-Dlg,NEDLG,SAP-102,SAP102
  • Gene Description:
  • discs, large homolog 3 (Drosophila)
  • Other Designations:
  • OTTHUMP00000023475,OTTHUMP00000023476,bA291O7.3 (discs, large Drosophila homolog 3 (neuroendocrine-dlg) ),discs large homolog 3,discs, large homolog 3 (neuroendocrine-dlg, Drosophila),neuroendocrine-dlg,synapse-associated protein 102
  • RSS
  • YouTube
  • Linkedin
  • Facebook