Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYH9 polyclonal antibody

  • Catalog # : PAB28470
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant MYH9
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human MYH9
  • Sequence:
  • REQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry(1:1000-1:2500)
    Immunofluorescence(1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human kidney with MYH9 polyclonal antibody (Cat # PAB28470) shows distinct cytoplasmic positivity in cells in glomeruli.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251MG with MYH9 polyclonal antibody (Cat # PAB28470) at 1-4 ug/ml shows positivity in plasma membrane, cytoplasm & cytoskeleton (actin filaments).
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4627
  • Gene Name:
  • MYH9
  • Gene Alias:
  • DFNA17,EPSTS,FTNS,MGC104539,MHA,NMHC-II-A,NMMHCA
  • Gene Description:
  • myosin, heavy chain 9, non-muscle
  • Gene Summary:
  • This gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq
  • Other Designations:
  • MYH9 variant protein,OTTHUMP00000028706,cellular myosin heavy chain, type A,myosin, heavy polypeptide 9, non-muscle,non-muscle myosin heavy chain,non-muscle myosin heavy polypeptide 9,nonmuscle myosin heavy chain II-A
  • RSS
  • YouTube
  • Linkedin
  • Facebook