MYH9 monoclonal antibody (M03), clone 2B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MYH9 monoclonal antibody (M03), clone 2B3. Western Blot analysis of MYH9 expression in human kidney.
Western Blot (Cell lysate)
MYH9 monoclonal antibody (M03), clone 2B3. Western Blot analysis of MYH9 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of MYH9 expression in transfected 293T cell line by MYH9 monoclonal antibody (M03), clone 2B3.
Lane 1: MYH9 transfected lysate (Predicted MW: 10.01 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 0.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to MYH9 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MYH9.
Immunogen
MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MYH9 monoclonal antibody (M03), clone 2B3. Western Blot analysis of MYH9 expression in human kidney.Western Blot (Cell lysate)
MYH9 monoclonal antibody (M03), clone 2B3. Western Blot analysis of MYH9 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of MYH9 expression in transfected 293T cell line by MYH9 monoclonal antibody (M03), clone 2B3.
Lane 1: MYH9 transfected lysate (Predicted MW: 10.01 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 0.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MYH9 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — MYH9
Entrez GeneID
4627GeneBank Accession#
NM_002473.5Protein Accession#
NP_002464.1Gene Name
MYH9
Gene Alias
DFNA17, EPSTS, FTNS, MGC104539, MHA, NMHC-II-A, NMMHCA
Gene Description
myosin, heavy chain 9, non-muscle
Gene Ontology
HyperlinkGene Summary
This gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq
Other Designations
MYH9 variant protein|OTTHUMP00000028706|cellular myosin heavy chain, type A|myosin, heavy polypeptide 9, non-muscle|non-muscle myosin heavy chain|non-muscle myosin heavy polypeptide 9|nonmuscle myosin heavy chain II-A
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A myosin chaperone, UNC-45A, is a novel regulator of intestinal epithelial barrier integrity and repair.
Susana Lechuga, Alexander X Cartagena-Rivera, Afshin Khan, Bert I Crawford, Vani Narayanan, Daniel E Conway, Jaakko Lehtimäki, Pekka Lappalainen, Florian Rieder, Michelle S Longworth, Andrei I Ivanov.
FASEB Journal 2022 Mar; 36(5):e22290.
Application：IF, WB-Tr, Human, HT-29cf8, SK-CO15 cells.
-
A myosin chaperone, UNC-45A, is a novel regulator of intestinal epithelial barrier integrity and repair.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com