Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC26 polyclonal antibody

  • Catalog # : PAB24297
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant CDC26.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human CDC26.
  • Sequence:
  • MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:1000-1:2500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human cerebellum with CDC26 polyclonal antibody (Cat # PAB24297) shows strong nuclear positivity in purkinje cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • CDC26
  • Gene Alias:
  • C9orf17
  • Gene Description:
  • cell division cycle 26 homolog (S. cerevisiae)
  • Gene Summary:
  • The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. [provided by RefSeq
  • Other Designations:
  • CDC26 subunit of anaphase promoting complex,OTTHUMP00000021952
  • RSS
  • YouTube
  • Linkedin
  • Facebook