Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RICS polyclonal antibody

  • Catalog # : PAB23276
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant RICS.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human RICS.
  • Sequence:
  • ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human colon with RICS polyclonal antibody (Cat # PAB23276) shows strong cytoplasmic and membrane positivity in glandular cells at 1:50-1:200 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9743
  • Gene Name:
  • RICS
  • Gene Alias:
  • GC-GAP,GRIT,KIAA0712,MGC1892,p200RhoGAP,p250GAP
  • Gene Description:
  • Rho GTPase-activating protein
  • Gene Summary:
  • RICS is a neuron-associated GTPase-activating protein that may regulate dendritic spine morphology and strength by modulating Rho GTPase (see RHOA; MIM 165390) activity (Okabe et al., 2003 [PubMed 12531901]).[supplied by OMIM
  • Other Designations:
  • GAB-associated CDC42,RhoGAP involved in the -catenin-N-cadherin and NMDA receptor signaling,brain-specific Rho GTP-ase-activating protein,rac GTPase activating protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook