Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNTB1 polyclonal antibody

  • Catalog # : PAB21733
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant SNTB1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SNTB1.
  • Sequence:
  • QGCHNSAELIAEISTACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSDDG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:10-1:20)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human kidney with SNTB1 polyclonal antibody (Cat # PAB21733) shows weak cytoplasmic positivity in tubular cells at 1:10-1:20 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6641
  • Gene Name:
  • SNTB1
  • Gene Alias:
  • 59-DAP,A1B,BSYN2,DAPA1B,FLJ22442,MGC111389,SNT2,SNT2B1,TIP-43
  • Gene Description:
  • syntrophin, beta 1 (dystrophin-associated protein A1, 59kDa, basic component 1)
  • Gene Summary:
  • Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq
  • Other Designations:
  • basic beta 1 syntrophin,dystrophin-associated protein A1, 59kD, basic component 1,syntrophin, beta 1 (dystrophin-associated protein A1, 59kD, basic component 1),tax interaction protein 43
  • RSS
  • YouTube
  • Linkedin
  • Facebook