Product Browser

Last updated: 2016/9/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SSR3 polyclonal antibody

  • Catalog # : PAB20781
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant SSR3.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SSR3.
  • Sequence:
  • VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of cell lysates with SSR3 polyclonal antibody (Cat # PAB20781).
    Lane 1 : NIH/3T3
    Lane 2 : NBT-II
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SSR3 polyclonal antibody (Cat # PAB20781).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human colon with SSR3 polyclonal antibody (Cat # PAB20781) shows strong cytoplasmic positivity in glandular cells.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6747
  • Gene Name:
  • SSR3
  • Gene Alias:
  • TRAPG
  • Gene Description:
  • signal sequence receptor, gamma (translocon-associated protein gamma)
  • Gene Summary:
  • The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. The protein encoded by this gene is the gamma subunit and is predicted to span the membrane four times. [provided by RefSeq
  • Other Designations:
  • SSR gamma,TRAP-complex gamma subunit,TRAP-gamma,signal sequence receptor gamma subunit,translocon-associated protein gamma subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook