YIF1A polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with YIF1A polyclonal antibody (Cat # PAB20773) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with YIF1A polyclonal antibody (Cat # PAB20773) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human smooth muscle with YIF1A polyclonal antibody (Cat # PAB20773) shows strong cytoplasmic positivity in smooth muscle cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with YIF1A polyclonal antibody (Cat # PAB20773) at 1-4 ug/mL dilution shows positivity in golgi apparatus, vesicles.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant YIF1A.
Immunogen
Recombinant protein corresponding to amino acids of human YIF1A.
Sequence
ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with YIF1A polyclonal antibody (Cat # PAB20773) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with YIF1A polyclonal antibody (Cat # PAB20773) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human smooth muscle with YIF1A polyclonal antibody (Cat # PAB20773) shows strong cytoplasmic positivity in smooth muscle cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with YIF1A polyclonal antibody (Cat # PAB20773) at 1-4 ug/mL dilution shows positivity in golgi apparatus, vesicles. -
Gene Info — YIF1A
Entrez GeneID
10897Protein Accession#
O95070Gene Name
YIF1A
Gene Alias
54TM, FinGER7, YIF1, YIF1P
Gene Description
Yip1 interacting factor homolog A (S. cerevisiae)
Omim ID
611484Gene Ontology
HyperlinkOther Designations
OTTHUMP00000128268|Yip1 interacting factor homolog|Yip1p-interacting factor|putative Rab5-interacting protein|putative transmembrane protein 54TMp
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com