DIAPH2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with DIAPH2 polyclonal antibody (Cat # PAB20307) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with DIAPH2 polyclonal antibody (Cat # PAB20307) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with DIAPH2 polyclonal antibody (Cat # PAB20307) shows cytoplasmic positivity in cells of seminiferus ducts at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with DIAPH2 polyclonal antibody (Cat # PAB20307) at 1-4 ug/mL dilution shows positivity in nucleoli, cytoplasm, vesicles.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant DIAPH2.
Immunogen
Recombinant protein corresponding to amino acids of human DIAPH2.
Sequence
GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with DIAPH2 polyclonal antibody (Cat # PAB20307) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with DIAPH2 polyclonal antibody (Cat # PAB20307) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with DIAPH2 polyclonal antibody (Cat # PAB20307) shows cytoplasmic positivity in cells of seminiferus ducts at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with DIAPH2 polyclonal antibody (Cat # PAB20307) at 1-4 ug/mL dilution shows positivity in nucleoli, cytoplasm, vesicles. -
Gene Info — DIAPH2
Entrez GeneID
1730Protein Accession#
O60879Gene Name
DIAPH2
Gene Alias
DIA, DIA2, DRF2, FLJ11167, POF, POF2
Gene Description
diaphanous homolog 2 (Drosophila)
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the diaphanous subfamily of the formin homology family of proteins. This gene may play a role in the development and normal function of the ovaries. Defects in this gene have been linked to premature ovarian failure 2. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000024270|OTTHUMP00000062171|diaphanous 2|diaphanous-related formin-2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com