Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDGFA polyclonal antibody

  • Catalog # : PAB16158
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against PDGFA.
  • Immunogen:
  • Human PDGFA.
  • Sequence:
  • VKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVR
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Isotype:
  • IgG
  • Recommend Usage:
  • ELISA (1-2 ug/mL)
    Western Blot (2-10 ug/mL)
    Immunohistochemistry (2-10 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In TBS, pH 7.4 (50% glycerol, 1% BSA, 0.03% Proclin).
  • Storage Instruction:
  • Store at 4°C for 1 month. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Immunohistochemistry
  • ELISA
  • Application Image
  • Western Blot
  • Immunohistochemistry
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5154
  • Gene Name:
  • PDGFA
  • Gene Alias:
  • PDGF-A,PDGF1
  • Gene Description:
  • platelet-derived growth factor alpha polypeptide
  • Gene Summary:
  • The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • PDGF A-chain,platelet-derived growth factor alpha,platelet-derived growth factor alpha chain,platelet-derived growth factor alpha isoform 2 preproprotein
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook