LILRB1 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LILRB1 (Q8NHL6, 24 a.a. - 461 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Sequence
GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV
Host
Viruses
Theoretical MW (kDa)
48.5
Form
Liquid
Preparation Method
Baculovirus expression system
Purity
> 95% by SDS-PAGE
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
Measured by the ability of the immobilized protein to support the adhesion of HSB2 human peripheral blood acute lymphoblastic leukemia cells. When cells are added to LILRB1 coated plates 5 ug/ml. This effect is more to 50%.
Quality Control Testing
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer
In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of bioactivity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — LILRB1
Entrez GeneID
10859Protein Accession#
Q8NHL6Gene Name
LILRB1
Gene Alias
CD85, CD85J, FLJ37515, ILT2, LIR-1, LIR1, MIR-7, MIR7
Gene Description
leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
Omim ID
604811Gene Ontology
HyperlinkGene Summary
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CD85 antigen|Ig-like transcript 2|OTTHUMP00000068384|OTTHUMP00000068385|OTTHUMP00000068386|OTTHUMP00000068408|immunoglobulin-like transcript 2|leukocyte Ig-like receptor-1|leukocyte immunoglobulin-like receptor 1|leukocyte immunoglobulin-like receptor sub
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com