Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL7 (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P6997
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL7 recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is < 0.8 ng/mL. The specific activity is > 7 x 108 IU/mg
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P6997
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 8.0.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measured in a cell proliferation assay using PHAactivated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.8 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3574
  • Gene Name:
  • IL7
  • Gene Alias:
  • IL-7
  • Gene Description:
  • interleukin 7
  • Gene Summary:
  • The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. [provided by RefSeq
  • Other Designations:
  • IL7 nirs variant 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook