Product Browser

Last updated: 2022/7/3

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

EGF (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P6991
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EGF recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRLE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 0.05-0.12 ng/mL. The specific activity is approximately > 1.4 x 106 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P6991
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 8.0.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 0.05-0.12 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1950
  • Gene Name:
  • EGF
  • Gene Alias:
  • HOMG4,URG
  • Gene Description:
  • epidermal growth factor (beta-urogastrone)
  • Gene Summary:
  • Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. [provided by RefSeq
  • Other Designations:
  • urogastrone
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook