Product Browser

Last updated: 2019/12/1

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF13B (Human) Recombinant Protein BioActive

  • Catalog # : P6406
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF13B (O14836) recombinant protein expressed in E. Coli.
  • Sequence:
  • SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17
  • Form:
  • Lyophilized
  • Purity:
  • > 98%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • Determined by its ability to block human BAFF induced T2B cell survival using a concentration range of 1-3 ug/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Gene Name:
  • TNFRSF13B
  • Gene Alias:
  • CD267,CVID,FLJ39942,MGC133214,MGC39952,TACI,TNFRSF14B
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 13B
  • Gene Summary:
  • The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000065442,transmembrane activator and CAML interactor,tumor necrosis factor receptor 13B
  • RSS
  • YouTube
  • Linkedin
  • Facebook