Product Browser

Last updated: 2019/8/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL17 (Human) Recombinant Protein 

  • Catalog # : P6249
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL17 (Q92583) recombinant protein expressed in E.Coli.
  • Sequence:
  • ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8.1
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL)
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Entrez GeneID:
  • 6361
  • Gene Name:
  • CCL17
  • Gene Alias:
  • A-152E5.3,ABCD-2,MGC138271,MGC138273,SCYA17,TARC
  • Gene Description:
  • chemokine (C-C motif) ligand 17
  • Gene Summary:
  • This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164673,T cell-directed CC chemokine,small inducible cytokine A17,small inducible cytokine subfamily A (Cys-Cys), member 17,thymus and activation-regulated chemokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook