Product Browser

Last updated: 2019/9/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL12 (Human) Recombinant Protein 

  • Catalog # : P6232
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL12 (P48061) recombinant protein expressed in E.Coli.
  • Sequence:
  • KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL)
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 6387
  • Gene Name:
  • CXCL12
  • Gene Alias:
  • PBSF,SCYB12,SDF-1a,SDF-1b,SDF1,SDF1A,SDF1B,TLSF-a,TLSF-b,TPAR1
  • Gene Description:
  • chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
  • Gene Summary:
  • For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000019491,stromal cell-derived factor 1 delta,stromal cell-derived factor 1 gamma,stromal cell-derived factor 1a
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook