Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Vote for Cancer Research Topics & Genes to Win One Free Antibody
pathway

Lep (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4604
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Lep (Q544U0) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16.1
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation of BaF/3. The expected ED50 for this effect is 0.4-0.6 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4604
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized with 0.1% TFA.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Serial dilutions of mouse Lep were added to Baf/3 cells. After 44 hours cell proliferation was measured and the linear portion of the curve was used to determine the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Lep
  • Gene Alias:
  • ob,obese
  • Gene Description:
  • leptin
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook