Product Browser

Last updated: 2021/4/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Csf3 (Mouse) Recombinant Protein BioActive

  • Catalog # : P4594
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Csf3 (P09920) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation of mouse M-NFS-60 cells. The expected ED50 for this effect is 8-12 pg/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4594
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Serial dilutions of mouse Csf3, starting at 10 ng/mL, were added to NFS-60 cells. After 69 hours, cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Csf3
  • Gene Alias:
  • Csfg,G-CSF,MGI-IG
  • Gene Description:
  • colony stimulating factor 3 (granulocyte)
  • Other Designations:
  • OTTMUSP00000006785,colony stimulating factor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook