Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NGF (Human) Recombinant ProteinBioActive

  • Catalog # : P4432
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NGF (P01138) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 27.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to stimulate the proliferation of TF-1 cells. The expected ED50 for this effect is 0.6-1 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4432
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Serial dilutions of human NGF, starting at 100 ng/mL, were added to TF-1 cells growing in GM-SCF free media. Cell proliferation was measure after 63 hours and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4803
  • Gene Name:
  • NGF
  • Gene Alias:
  • Beta-NGF,HSAN5,MGC161426,MGC161428,NGFB
  • Gene Description:
  • nerve growth factor (beta polypeptide)
  • Gene Summary:
  • This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000013653,beta-nerve growth factor,nerve growth factor, beta polypeptide,nerve growth factor, beta subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook