Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL19 (Human) Recombinant ProteinBioActive

  • Catalog # : P4430
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL19 (P55774) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to chemoattract human T cells and is detectable starting at 5 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4430
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Human T cells were allowed to migrate to human CCL19 at (0, 5, 20, 100 and 500 ng/mL). After 4 hours, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6363
  • Gene Name:
  • CCL19
  • Gene Alias:
  • CKb11,ELC,MGC34433,MIP-3b,MIP3B,SCYA19
  • Gene Description:
  • chemokine (C-C motif) ligand 19
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq
  • Other Designations:
  • CC chemokine ligand 19,CK beta-11,EBI1-ligand chemokine,OTTHUMP00000000531,OTTHUMP00000021295,beta chemokine exodus-3,exodus-3,macrophage inflammatory protein 3-beta,small inducible cytokine A19,small inducible cytokine subfamily A (Cys-Cys), member 19
  • RSS
  • YouTube
  • Linkedin
  • Facebook