CCL19 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Lane 1: non-reducing conditions
Lane 2: reducing conditions
Result of activity analysis
Result of activity analysis
Human T cells were allowed to migrate to human CCL19 at (0, 5, 20, 100 and 500 ng/mL). After 4 hours, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.
-
Specification
Product Description
Human CCL19 (P55774) recombinant protein expressed in Escherichia coli.
Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Host
Escherichia coli
Theoretical MW (kDa)
8.800000000000001
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the ability to chemoattract human T cells and is detectable starting at 5 ng/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Lane 1: non-reducing conditions
Lane 2: reducing conditionsStorage Buffer
No additive
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — CCL19
Entrez GeneID
6363Protein Accession#
P55774Gene Name
CCL19
Gene Alias
CKb11, ELC, MGC34433, MIP-3b, MIP3B, SCYA19
Gene Description
chemokine (C-C motif) ligand 19
Omim ID
602227Gene Ontology
HyperlinkGene Summary
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq
Other Designations
CC chemokine ligand 19|CK beta-11|EBI1-ligand chemokine|OTTHUMP00000000531|OTTHUMP00000021295|beta chemokine exodus-3|exodus-3|macrophage inflammatory protein 3-beta|small inducible cytokine A19|small inducible cytokine subfamily A (Cys-Cys), member 19
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com