Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KITLG (Human) Recombinant ProteinBioActive

  • Catalog # : P3666
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KITLG (P21583, 26 a.a. - 189 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is ≤2.0 ng/mL, corresponding to a specific activity of ≥ 5 x 105 units/mg.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4254
  • Gene Name:
  • KITLG
  • Gene Alias:
  • DKFZp686F2250,KL-1,Kitl,MGF,SCF,SF,SHEP7
  • Gene Description:
  • KIT ligand
  • Gene Summary:
  • This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • mast cell growth factor,steel factor,stem cell factor
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook