Product Browser

Last updated: 2014/12/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NGF (Human) Recombinant ProteinBioActive

  • Catalog # : P3657
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NGF (P01138, 122 a.a. - 241 a.a.) partial recombinant protein expressed in CHO cells.
  • Sequence:
  • SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 27
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 95% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the determined by its ability to proliferate TF-1 cells and was found to be in the range of 0.5 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM sodium acetate, 150 mM NaCl, pH 5.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4803
  • Gene Name:
  • NGF
  • Gene Alias:
  • Beta-NGF,HSAN5,MGC161426,MGC161428,NGFB
  • Gene Description:
  • nerve growth factor (beta polypeptide)
  • Gene Summary:
  • This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000013653,beta-nerve growth factor,nerve growth factor, beta polypeptide,nerve growth factor, beta subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook