Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

CCL13 (Human) Recombinant Protein   BioActive

  • Catalog # : P3648
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 25 ug
  • USD $ 259
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human CCL13 (Q99616, 1 a.a. - 98 a.a.) full-length recombinant protein. expressed in Escherichia coli.
  • Sequence:
  • MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
  • Theoretical MW (kDa):
  • 9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 98% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 20.0-40.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PB, 100mM NaCl, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6357
  • Gene Name:
  • CCL13
  • Gene Alias:
  • CKb10,MCP-4,MGC17134,NCC-1,NCC1,SCYA13,SCYL1
  • Gene Description:
  • chemokine (C-C motif) ligand 13
  • Gene Summary:
  • This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq
  • Other Designations:
  • CK-beta-10,monocyte chemoattractant protein 4,monocyte chemotactic protein 4,new CC chemokine 1,small inducible cytokine A13,small inducible cytokine subfamily A (Cys-Cys), member 13
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!