Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL15 (Human) Recombinant ProteinBioActive

  • Catalog # : P3619
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL15 (Q16663, 22 a.a. - 113 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 10
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6359
  • Gene Name:
  • CCL15
  • Gene Alias:
  • HCC-2,HMRP-2B,LKN1,Lkn-1,MIP-1d,MIP-5,NCC-3,NCC3,SCYA15,SCYL3,SY15
  • Gene Description:
  • chemokine (C-C motif) ligand 15
  • Gene Summary:
  • This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene CCL14, and are represented as GeneID: 348249. [provided by RefSeq
  • Other Designations:
  • CC chemokine 3,MIP-1 delta,OTTHUMP00000163955,chemokine CC-2,leukotactin 1,macrophage inflammatory protein 5,small inducible cytokine subfamily A (Cys-Cys), member 15
  • RSS
  • YouTube
  • Linkedin
  • Facebook