Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL17 (Human) Recombinant Protein

  • Catalog # : P3541
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL17 (NP_002978, 24 a.a. - 94 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 10.3
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3541
  • Storage Buffer:
  • In PBS, pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6361
  • Gene Name:
  • CCL17
  • Gene Alias:
  • A-152E5.3,ABCD-2,MGC138271,MGC138273,SCYA17,TARC
  • Gene Description:
  • chemokine (C-C motif) ligand 17
  • Gene Summary:
  • This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164673,T cell-directed CC chemokine,small inducible cytokine A17,small inducible cytokine subfamily A (Cys-Cys), member 17,thymus and activation-regulated chemokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook